Snoovatar

/u/goldentreesap

Last updated 2 weeks ago

Summary #

Your best, your worst and the basics.

Limited to the 1000 most recent submissions and comments.

redditor since

Feb 21, 2025

2 months, 3 weeks ago

data available from

Apr 28, 2025

longest period between two consecutive posts

16 minutes

Apr 28, 2025 to Apr 28, 2025

gilded

0 submissions and 0 times from comments

submission karma

10 from 10 submissions

1.0 average karma per submission

327 total submission karma reported by reddit

comment karma

0 from 0 comments

0.0 average karma per comment

19 total comment karma reported by reddit

best comment

worst comment

best submission

28 [M4F] #Calgary Switch That Wants So Badly To Please You | 6'2" | British Accent (permalink)

worst submission

28 [M4F] #Calgary Switch That Wants So Badly To Please You | 6'2" | British Accent (permalink)

Synopsis #

Accuracy or making sense not guaranteed. Results may be incorrect or misleading.

Uncertain data is in orange. Follow # links for sources.

Your top subs #

To repost, or not to repost, that is the question.

Based on your average karma earnings.

Best Average Karma

1 karma/submission on average

1 total karma over 1 submissions

Worst Average Karma

1 karma/submission on average

1 total karma over 1 submissions

Activity Over Last 60 Days #

You're not addicted, you're committed.

Darker dots mean more activity. All times in UTC

Created with Highcharts 11.4.5
Created with Highcharts 11.4.5PostsKarma

Activity Timeline #

First they came for the lurkers...

Hover over the circles for more info.

Created with Highcharts 11.4.5PostsKarma2025-0202.557.51012.502.557.51012.5

Activity by Weekday #

Bored on reddit? Let's see what's on reddit.

Hover over the bars for more info.

Created with Highcharts 11.4.5KarmaPostsPostsKarmaSunMonTueWedThuFriSat

Activity by Time of Day #

Do you even sleep, bro?

Hover over the bars for more info. All times in UTC

Created with Highcharts 11.4.5KarmaPostsPostsKarma01234567891011121314151617181920212223

Posts Across Topics #

Look at you, how versatile!

Hover over the chart for more info.

Created with Highcharts 11.4.5AllOtherAdult and NSFWGenericGenericDiscussionDiscussi…GenericSocial Science and HumanitiesSoci…RelationshipsRelations…Age Gap RelationshipsAge Gap Relat…

Submissions By Type and Domain #

You're still the master of your domains.

Hover over the chart for more info.

Created with Highcharts 11.4.5AllSelfYYCHooksUpSpanking_PersonalsSpanking_Pe…AdultNursingPersonalsAdultNursing…DirtyPenPersonalsDirtyPenPers…BreastPlayPersonalsBreastPlayPe…FemaleDommePersonalsFemaleDom…BDSMpersonalsBDSMperson…femdompersonalsfemdompers…Otheri.redd.it

Activity Across Subreddits (by Karma) #

Where might /r/random take you next?

Hover for more info.

Created with Highcharts 11.4.5AdultNursingPersonalsBreastPlayPersonalsDirtyPenPersonalsFemaleDommePersonalsSpanking_PersonalsYYCHooksUpAgeGapPersonalsBDSMpersonalsCalgaryGoneWildAgainfemdompersonals

Activity Across Subreddits (by Posts) #

Where might /r/random take you next?

Hover for more info.

Created with Highcharts 11.4.5AdultNursingPersonalsBreastPlayPersonalsDirtyPenPersonalsFemaleDommePersonalsSpanking_PersonalsYYCHooksUpAgeGapPersonalsBDSMpersonalsCalgaryGoneWildAgainfemdompersonals

Most Common Words #

Don't forget to use that new word you learned!

Size of a word is directly proportional to its frequency.

loveworshipdeepenergyfavoritegivingmakecalgaryconnectionteasinggamestravelingskiingsphmommydompraiseopenkinkrealdirtyplayfullostunforgettablehorrorlaughfeelingaddictedplayguyswitchfunonlinedmscoolvibewildreadyhookupshonestlymattersbuildingtensionmessagesphysicalbeatsslowburnsextingconversationsturnconfessionsnaughtyphonecallswordssquirmseatcravefanhugegamerobsessedpvpfpspcrustvaloranttarkovbonuspointstypetrashtalkflirtmakinggreenfuelslivedmultiplecountriesadventurechaosexplainhikingtripsmoviesgenuinelycreepcomedieswrongdarkfilmsleavewreckedbigkinksanaldenialmoanflirtyafraiddivedarkersideteaseexploresendgoodkindanradult

Common Words Table #

Don't forget to use that new word you learned!

Your word frequency.

Word Frequency
love 7
worship 6
deep 4
energy 4
favorite 4
submissive 4
giving 4
make 3
calgary 3
connection 3
teasing 3
games 3
traveling 3
skiing 3
sph 3
mommy 3
dom 3
praise 3
degradation 3
pussy 3
open 3
kink 3
real 2
dirty 2
playful 2
lost 2
unforgettable 2
horror 2
laugh 2
feeling 2
addicted 2
play 2
guy 2
gaming 2
cooking 2
switch 2
dominant 2
depending 2
fun 2
online 2
dms 2
cool 1
vibe 1
wild 1
ready 1
hookups 1
honestly 1
matters 1
building 1
tension 1
messages 1
physical 1
beats 1
slow 1
burn 1
sexting 1
conversations 1
turn 1
confessions 1
naughty 1
phone 1
calls 1
words 1
squirm 1
seat 1
crave 1
fan 1
huge 1
gamer 1
obsessed 1
pvp 1
fps 1
pc 1
rust 1
valorant 1
tarkov 1
bonus 1
points 1
type 1
trash 1
talk 1
flirt 1
making 1
green 1
fuels 1
lived 1
multiple 1
countries 1
beautiful 1
adventure 1
chaos 1
nights 1
explain 1
spontaneous 1
hiking 1
trips 1
movies 1
genuinely 1
creep 1
twisted 1
comedies 1
wrong 1
moments 1
dark 1
romance 1
films 1
leave 1
wrecked 1
big 1
kinks 1
edging 1
anal 1
orgasm 1
denial 1
filthy 1
mixed 1
moan 1
kinky 1
flirty 1
curious 1
afraid 1
dive 1
flirting 1
exploring 1
darker 1
side 1
wanting 1
needing 1
tease 1
explore 1
send 1
craziest 1
fantasy 1
trouble 1
good 1
kind 1
anr 1
adult 1
nursing 1
breast 1

Corpus Statistics #

If only you had typed this much for that college essay...

Time spent calculated using average of 40 WPM.

Your Typing Stats

total words in your posts

512

unique words

253 (49.41% of total words)

time spent typing posts

0.21 hours

karma per word

0.0