Snoovatar

/u/DLZ9__

Last updated 2 weeks ago

Summary #

Your best, your worst and the basics.

Limited to the 1000 most recent submissions and comments.

redditor since

Jul 30, 2024

9 months, 1 week ago

data available from

Aug 18, 2024

longest period between two consecutive posts

3 months

Jan 21, 2025 to Apr 26, 2025

gilded

0 submissions and 0 times from comments

submission karma

12 from 10 submissions

1.2 average karma per submission

14 total submission karma reported by reddit

comment karma

718 from 105 comments

6.84 average karma per comment

551 total comment karma reported by reddit

best comment

😂😂😂 always good to see young players get a chance to make their debut! (permalink)

worst comment

I like it! Looks like an all around fun build. (permalink)

best submission

23 [M4F] #London - Seeking a passionate face rider (permalink)

worst submission

23 [M4F] #Norfolk - & London (UK) Sit on, smother and ride my face (permalink)

Synopsis #

Accuracy or making sense not guaranteed. Results may be incorrect or misleading.

Uncertain data is in orange. Follow # links for sources.

you like to play

nba 2k

sports and teams you like

chelsea f.c.

fifa and ea sports fc

things you've said you like

higher offensive rebound #

you have a

Your top subs #

Friends tell friends where to earn karma.

Based on your average karma earnings.

Best Average Karma

1.5 karma/submission on average

3 total karma over 2 submissions

13.28 karma/comment on average

332 total karma over 25 comments

Worst Average Karma

1 karma/submission on average

2 total karma over 2 submissions

1 karma/comment on average

1 total karma over 1 comments

Activity Over Last 60 Days #

You're not addicted, you're committed.

Darker dots mean more activity. All times in UTC

Created with Highcharts 11.4.5
Created with Highcharts 11.4.5PostsKarma

Activity Timeline #

First they came for the lurkers...

Hover over the circles for more info.

Created with Highcharts 11.4.5PostsKarma2024-072024-112025-03012024036048060001020304050

Activity by Weekday #

Have you tried /r/outside?

Hover over the bars for more info.

Created with Highcharts 11.4.5KarmaPostsPostsKarmaSunMonTueWedThuFriSat

Activity by Time of Day #

Do you even sleep, bro?

Hover over the bars for more info. All times in UTC

Created with Highcharts 11.4.5KarmaPostsPostsKarma01234567891011121314151617181920212223

Posts Across Topics #

Look at you, how versatile!

Hover over the chart for more info.

Created with Highcharts 11.4.5AllGamingVideo GamesNBA 2KSportsSoccerChelsea F.C.FootballFIFA and EA Sports FCFIFA and EA Sports …Adult and NSFWAdul…GenericGen…GenericDiscussionDisc…GenericGen…GenericGen…GenericGen…Automation and Moderation ToolsAut…

Submissions By Type and Domain #

Those who can, submit. Those who can't, lurk.

Hover over the chart for more info.

Created with Highcharts 11.4.5AllSelffemdompersonalsfemdompers…RandomActsOfMuffDiveWhatIsMyCQSNBA2kNewToReddit

Activity Across Subreddits (by Karma) #

Where might /r/random take you next?

Hover for more info.

Created with Highcharts 11.4.5AskRedditEASportsFCchelseafcsoccerso…NBA2kNewToRedditNewToRedd…RandomActsOfMuffDiveRandomActsOfMuffD…facesittingfemdompersonalsfe…avatartradingav…WhatIsMyCQSWhatIsMyC…

Activity Across Subreddits (by Posts) #

Where might /r/random take you next?

Hover for more info.

Created with Highcharts 11.4.5AskRedditEASportsFCchelseafcsoccerNBA2kNewToRedditRandomActsOfMuffDiveRandomActsOfM…facesittingfemdompersonalsavatartradingWhatIsMyCQSWhatIsMy…

Most Common Words #

Don't forget to use that new word you learned!

Size of a word is directly proportional to its frequency.

facegoodlovebuildmakegreatreachhygienebigplayshootingballtestedfunworthlongwomantallcaucasianslimfitbodyfacesittingsmotheredguysuggestplayersbrokenthingoffensivegameslolfeelpghithandlenoticedlegenddifferencehofyeahpointpasshigherdominantbrownlaidmeetriddeneatassagehappypostsolidguardagreehighreboundingchampseasiersbteamplayingrewardsweekhardermanspotfindlimitlesspersonallymidrangedeeprecommendhahafactsmaxyearsplayerforwardmodesmindjobprefersoundscheckhearingwestenjoyshaireasyexpectpositionscutelongerddfmessagesattypebackshareagedtakessubsfunnydeservedmotmcompletelyforgotbuydisasiclosezoumamarkdefeatspurposemeterfelixcompetingshotwingrefreshingyoungchanceexperiencedhappenedreportdoubtmatchstruggledefmikewangjumpstupidideaaddloanswaittomorrowstartseasonputdivisionsmanagedsavedrankterribleslowstrugglingsquadbadwinsrivalsmalllotbuttonattemptrhythmfastjumpshotworksconsistentlystephcurrylaughtodaypassedendedlolhmmtakingshootsilverbadgetimedmovepaceissuesbadgesstevediscmesssignlolfirstposition

Common Words Table #

Don't forget to use that new word you learned!

Your word frequency.

Word Frequency
face 12
good 8
love 7
build 7
make 5
great 5
reach 5
hygiene 5
big 4
play 4
shooting 4
ball 4
tested 4
fun 4
worth 4
long 4
woman 4
tall 4
caucasian 4
slim 4
fit 4
body 4
facesitting 4
smothered 4
guy 3
suggest 3
players 3
broken 3
thing 3
offensive 3
games 3
lol 3
feel 3
pg 3
hit 3
handle 3
noticed 3
legend 3
difference 3
hof 3
yeah 3
point 3
pass 3
higher 3
dominant 3
brown 3
laid 3
meet 3
ridden 3
eat 3
ass 3
age 3
happy 3
reciprocation 3
post 3
solid 2
guard 2
agree 2
high 2
rebounding 2
champs 2
easier 2
sb 2
team 2
playing 2
rewards 2
week 2
harder 2
man 2
spot 2
find 2
limitless 2
personally 2
mid 2
range 2
deep 2
recommend 2
haha 2
facts 2
max 2
years 2
player 2
forward 2
modes 2
mind 2
job 2
prefer 2
sounds 2
check 2
hearing 2
west 2
enjoys 2
hair 2
respectful 2
easy 2
bedroom 2
expect 2
positions 2
interested 2
location 2
description 2
cute 2
longer 2
ddf 2
message 2
sat 2
type 2
back 2
share 2
pictures 2
aged 2
takes 2
interest 2
subs 2
funny 1
deserved 1
motm 1
completely 1
forgot 1
buy 1
disasi 1
close 1
zouma 1
mark 1
defeats 1
purpose 1
meter 1
felix 1
competing 1
shot 1
wing 1
refreshing 1
young 1
chance 1
experienced 1
happened 1
report 1
doubt 1
match 1
struggle 1
def 1
mike 1
wang 1
jump 1
stupid 1
idea 1
add 1
loans 1
wait 1
tomorrow 1
start 1
season 1
put 1
divisions 1
managed 1
saved 1
rank 1
terrible 1
slow 1
struggling 1
squad 1
bad 1
wins 1
rival 1
small 1
lot 1
button 1
attempt 1
rhythm 1
fast 1
jumpshot 1
works 1
expecting 1
consistently 1
steph 1
curry 1
laugh 1
today 1
passed 1
ended 1
lolhmm 1
taking 1
shoot 1
silver 1
badge 1
upgrades 1
precision 1
timed 1
minimum 1
move 1
pace 1
issues 1
badges 1
steve 1
disc 1
mess 1
sign 1
lolfirst 1
position 1
thought 1

Corpus Statistics #

If you can't convince them, write more and confuse them.

Time spent calculated using average of 40 WPM.

Your Typing Stats

total words in your posts

2290

unique words

722 (31.53% of total words)

time spent typing posts

0.95 hours

karma per word

0.31