Snoovatar

/u/BuilderBurger22

Last updated 1 month ago

Summary #

Your best, your worst and the basics.

Limited to the 1000 most recent submissions and comments.

redditor since

Sep 23, 2018

6 years, 7 months ago

data available from

Oct 31, 2018

longest period between two consecutive posts

2 years

Mar 03, 2023 to Apr 03, 2025

gilded

0 submissions and 0 times from comments

submission karma

3333 from 61 submissions

54.64 average karma per submission

2562 total submission karma reported by reddit

comment karma

784 from 98 comments

8.0 average karma per comment

620 total comment karma reported by reddit

best comment

ah, yes. The Dog Log (permalink)

worst comment

The planets are aligned! the universe is about to explode!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! (permalink)

best submission

If you over saturate the images, you can really see how many stars there are (permalink)

worst submission

20 [M4F] #Online #Canada Looking for a soft dom to take it slow (permalink)

Synopsis #

Accuracy or making sense not guaranteed. Results may be incorrect or misleading.

Uncertain data is in orange. Follow # links for sources.

you like to play

kerbal space program

video games

minecraft

you are

terrible insomniac #

you like

pewdiepie content

blessed images

people in your family

brother #

you have a

Your top subs #

To repost, or not to repost, that is the question.

Based on your average karma earnings.

Best Average Karma

98.66 karma/submission on average

3157 total karma over 32 submissions

36.07 karma/comment on average

541 total karma over 15 comments

Worst Average Karma

0.67 karma/submission on average

2 total karma over 3 submissions

1 karma/comment on average

1 total karma over 1 comments

Activity Over Last 60 Days #

You're not addicted, you're committed.

Darker dots mean more activity. All times in UTC

Created with Highcharts 11.4.5
Created with Highcharts 11.4.5PostsKarma

Activity Timeline #

First they came for the lurkers...

Hover over the circles for more info.

Created with Highcharts 11.4.5PostsKarma2018-092019-012019-052019-092020-012020-052020-092021-012021-052021-092022-012022-052022-092023-012023-052023-092024-012024-052024-092025-01050010001500200025000510152025

Activity by Weekday #

That's all right, outdoors are overrated anyway.

Hover over the bars for more info.

Created with Highcharts 11.4.5KarmaPostsPostsKarmaSunMonTueWedThuFriSat

Activity by Time of Day #

Insomniacs of reddit, upvote!

Hover over the bars for more info. All times in UTC

Created with Highcharts 11.4.5KarmaPostsPostsKarma01234567891011121314151617181920212223

Posts Across Topics #

Jack of all trades, master of some.

Hover over the chart for more info.

Created with Highcharts 11.4.5AllGamingVideo GamesKerbal Space ProgramGenericMinecraftMin…GeneralMemesGenericDiscussionGenericPicturesPict…GenericGen…VideosVide…GenericGen…EntertainmentEnte…VideosVide…Pewdiepie ContentPew…PicturesPict…Blessed ImagesBles…

Submissions By Type and Domain #

Those who can, submit. Those who can't, lurk.

Hover over the chart for more info.

Created with Highcharts 11.4.5AllSelfKerbalSpaceProgramKerbal…Imagei.redd.itVideoyoutu.beyoutu.…youtube.comv.redd.itv.redd.…

Activity Across Subreddits (by Karma) #

Where might /r/random take you next?

Hover for more info.

Created with Highcharts 11.4.5AskRedditAskR…dankmemesdan…memesmildlyinfuriatingmildly…mildlyinterestingmi…Blessed_ImagesBlessed_Im…PewdiepieSubmissionsP…blursedimagesinspirobotins…EliteDangerousElite…KerbalSpaceProgramMinecraftMi…SeaofthievesSeaofthiev…StardewValleySta…thelongdarkthel…PleXPl…BDSMpersonals

Activity Across Subreddits (by Posts) #

Where might /r/random take you next?

Hover for more info.

Created with Highcharts 11.4.5AskRedditIdiotsInCarsIdiotsI…LinusTechTipsLinus…dankmemesmemesmildlyinfuriatingmildlyinfuriati…mildlyinterestingvideosBlessed_ImagesBlessed_Ima…PewdiepieSubmissionsPewdiepieSubmi…blursedimagesblurs…BoneAppleTeaBoneA…inspirobotinspiro…youtubeEliteDangerousKerbalSpaceProgramMinecraftSeaofthievesStardewValleythelongdarkFilmmakerskingdomthegamekingdo…PleXBDSMpersonalsBDSM…femdompersonalsfemdo…u_BuilderBurger22u_Buil…

Most Common Words #

A word is worth ten imgur links. True story.

Size of a word is directly proportional to its frequency.

playvideotimemediaprettydayfishingmusicbetatesterappbackmakemansolarjoblovefoundstorebegincloseaddplayerwatchhistoryblackfallevepeteatfacilitylifeeneoughbitmodsasdomtalkfunfinallysetreloadfixednormaluseruninstallreinstallloadfixworkedmileagevaryunableconnectserverroadtripchangesettingsadvancedexternalplaybackvlclistenplexrecordvoicelinesrestturnroomwhiteisleepinglivecloudhalfsizemineitmydadredditalbertahighdissthronuscostsusdileftsavourxboximagetop

Common Words Table #

A word is worth ten imgur links. True story.

Your word frequency.

Word Frequency
play 6
video 6
time 6
include 5
media 4
pretty 4
day 4
fishing 4
music 4
beta 3
tester 3
app 3
redownload 3
back 3
make 3
canada 3
friends 3
school 3
man 3
solar 3
job 3
enjoy 3
love 3
kinks 3
orgasm 3
worship 3
things 3
interested 3
hope 3
reading 3
found 2
store 2
begin 2
working 2
close 2
add 2
player 2
watch 2
history 2
background 2
noise 2
blend 2
turned 2
guess 2
black 2
woke 2
middle 2
called 2
fall 2
eve 2
computer 2
straight 2
kerbal 2
pet 2
system 2
hours 2
eat 2
facility 2
zombies 2
putting 2
life 2
sleep 2
eneough 2
drive 2
bit 2
type 2
mod 2
youthank 2
sas 2
western 2
white 2
curly 2
brown 2
hair 2
blue 2
university 2
years 2
couple 2
interest 2
dom 2
talk 2
fun 2
praise 2
give 2
control 2
chastity 2
body 2
inside 2
games 2
building 2
movies 2
lego 2
camping 2
send 2
insomniac 2
respond 2
exploring 2
main 2
finally 1
set 1
reload 1
fixed 1
normal 1
user 1
uninstall 1
reinstall 1
load 1
fix 1
worked 1
mileage 1
vary 1
unable 1
connect 1
server 1
road 1
trip 1
change 1
settings 1
advanced 1
external 1
playback 1
vlc 1
listen 1
plex 1
record 1
voicelines 1
goodsome 1
voice 1
lines 1
rest 1
turn 1
wanted 1
thing 1
room 1
whitei 1
short 1
sleeping 1
live 1
cloud 1
half 1
size 1
countryrepost 1
heroin 1
discoveryhaha 1
mine 1
brother 1
itmy 1
dad 1
invited 1
friend 1
reddit 1
logo 1
country 1
alberta 1
citizen 1
remember 1
story 1
lady 1
stormtrooper 1
costume 1
police 1
guys 1
asleep 1
herethanks 1
started 1
high 1
needed 1
bless 1
diss 1
prepaired 1
taco 1
bellits 1
thronus 1
costs 1
usdi 1
left 1
savour 1
landscape 1
leavingi 1
wallpaper 1
yearthe 1
gamed 1
junethe 1
original 1
xbox 1
image 1
backwards 1
killing 1
space 1
program 1
yawhy 1
mouth 1
top 1
hole 1
center 1
galaxyairbus 1
legal 1
platypus 1
illegal 1
export 1

Corpus Statistics #

If you can't convince them, write more and confuse them.

Time spent calculated using average of 40 WPM.

Your Typing Stats

total words in your posts

1851

unique words

744 (40.19% of total words)

time spent typing posts

0.77 hours

karma per word

0.42